PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_18393-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 178aa    MW: 19272.2 Da    PI: 6.1265
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_18393-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.69.9e-121664351
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                     +  r rr   NReA r++R++Kka  + Lee+vk+L a N++L+ +l+ 
  TRIUR3_18393-P1 16 AAPRPRRPLGNREAVRKYREKKKAHAAFLEEEVKQLRAANQQLQRRLQG 64
                     5678899999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.8E-121481IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9331663IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-151782No hitNo description
PfamPF077161.9E-131969IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.93E-92064No hitNo description
CDDcd146861.24E-102173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGDQVGVGHH EMRDAAAPRP RRPLGNREAV RKYREKKKAH AAFLEEEVKQ LRAANQQLQR  60
RLQGHATLEA EVARLRGLLF DVRAKIDAEA AGAFPFQKQC SVGSVACADP TLCFNNGNSE  120
VGGACWEDSS GPAAADYRFD EDGNGNGGAS REIDAPEQPA DRDFSRSTTT TTTTPDTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3719681e-154AK371968.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2144D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.12e-69putative bZIP transcription factor superfamily protein
TrEMBLM7YF651e-130M7YF65_TRIUA; Uncharacterized protein
STRINGMLOC_13410.14e-80(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.17e-21bZIP family protein